| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Asialoglycoprotein Receptor 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Asialoglycoprotein Receptor 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Asialoglycoprotein Receptor 2. This antibody reacts with human. The Asialoglycoprotein Receptor 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. Peptide sequence STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV. |
|---|
| Other Names | ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2 |
|---|
| Gene, Accession # | ASGR2, Gene ID: 433, Accession: P07307, SwissProt: P07307 |
|---|
| Catalog # | NBP1-54888 |
|---|
| Price | |
|---|
| Order / More Info | Asialoglycoprotein Receptor 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|