| 产品详情 |
| Edit |   |
| Antigenic Specificity | Asialoglycoprotein Receptor 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Asialoglycoprotein Receptor 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Asialoglycoprotein Receptor 2. This antibody reacts with human. The Asialoglycoprotein Receptor 2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Asialoglycoprotein Receptor 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC |
| Other Names | ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2 |
| Gene, Accession # | ASGR2, Gene ID: 433 |
| Catalog # | NBP1-85578 |
| Price | |
| Order / More Info | Asialoglycoprotein Receptor 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|