| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRAILR1/TNFRSF10A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAILR1/TNFRSF10A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAILR1/TNFRSF10A. This antibody reacts with human. The TRAILR1/TNFRSF10A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRAIL R1/TNFRSF10A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA |
|---|
| Other Names | APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis factor receptor superfamily member 10A, tumor necrosis factor receptor superfamily, member 10a |
|---|
| Gene, Accession # | TNFRSF10A, Gene ID: 8797 |
|---|
| Catalog # | NBP2-56818 |
|---|
| Price | |
|---|
| Order / More Info | TRAILR1/TNFRSF10A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|