| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CMC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CMC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CMC1. This antibody reacts with human. The CMC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
|---|
| Other Names | C3orf68, chromosome 3 open reading frame 68, cmc1p, COX assembly mitochondrial protein homolog, COX assembly mitochondrial protein homolog (S. cerevisiae), CX9C mitochondrial protein required for full expression of COX 1, DKFZp779D0833, MGC61571, mitochondrial metallochaperone-like protein |
|---|
| Gene, Accession # | CMC1, Gene ID: 152100 |
|---|
| Catalog # | NBP1-86786 |
|---|
| Price | |
|---|
| Order / More Info | CMC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|