| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALG2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG2. This antibody reacts with human. The ALG2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLH |
|---|
| Other Names | alpha-1,3-mannosyltransferase ALG2, alpha-1,3-mannosyltransferase), asparagine-linked glycosylation 2 homolog (S. cerevisiae, asparagine-linked glycosylation 2 homolog (yeast, asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 2 homolog, CDGII, EC 2.4.1, EC 2.4.1.-, FLJ14511, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase, hALPG2, homolog of yeast ALG2, NET38 |
|---|
| Gene, Accession # | ALG2, Gene ID: 85365 |
|---|
| Catalog # | NBP1-85715 |
|---|
| Price | |
|---|
| Order / More Info | ALG2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|