| Edit |   |
| Antigenic Specificity | ALG11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALG11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG11. This antibody reacts with human. The ALG11 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ALG11. Peptide sequence LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA. |
| Other Names | asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast), asparagine-linked glycosylation protein 11 homolog |
| Gene, Accession # | ALG11, Gene ID: 440138, Accession: NP_001004127, SwissProt: NP_001004127 |
| Catalog # | NBP1-91576 |
| Price | |
| Order / More Info | ALG11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |