| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALG10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALG10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG10. This antibody reacts with human. The ALG10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ALG10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP |
|---|
| Other Names | ALG10A, alpha-1,2-glucosyltransferase ALG10-A, alpha-1,2-glucosyltransferase), alpha2-glucosyltransferase, Alpha-2-glucosyltransferase ALG10-A, asparagine-linked glycosylation 10 homolog (yeast, asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S.pombe), asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog(yeast), Asparagine-linked glycosylation protein 10 homolog A, derepression of ITR1 expression 2 homolog, DIE2, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.16, FLJ14751, KCR1, potassium channel regulator 1 |
|---|
| Gene, Accession # | ALG10, Gene ID: 84920, Accession: Q5BKT4, SwissProt: Q5BKT4 |
|---|
| Catalog # | NBP2-14281 |
|---|
| Price | |
|---|
| Order / More Info | ALG10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|