| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALG1. This antibody reacts with human, mouse. The ALG1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ALG1(asparagine-linked glycosylation 1 homolog) The peptide sequence was selected from the N terminal of ALG1. Peptide sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG. |
| Other Names | asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase), asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 1 homolog, beta-1,4 mannosyltransferase, beta-1,4-mannosyltransferase, chitobiosyldiphosphodolichol beta-mannosyltransferase, GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase, GDP-mannose-dolichol diphosphochitobiose mannosyltransferase, hMat-1, HMAT1EC 2.4.1.142, HMT-1, HMT1CDG1K, Mannosyltransferase-1, MT-1 |
| Gene, Accession # | ALG1, Gene ID: 56052, Accession: Q9BT22, SwissProt: Q9BT22 |
| Catalog # | NBP1-69510 |
| Price | |
| Order / More Info | ALG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|