| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IDH3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IDH3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to IDH3A. This antibody reacts with human. The IDH3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: alpha, mitochondrial |
|---|
| Immunogen | Synthetic peptides corresponding to IDH3A(isocitrate dehydrogenase 3 (NAD+) alpha) The peptide sequence was selected from the N terminal of IDH3A. Peptide sequence MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK. |
|---|
| Other Names | EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alpha, NAD(H)-specific isocitrate dehydrogenase alpha subunit, NAD+-specific ICDH |
|---|
| Gene, Accession # | IDH3A, Gene ID: 3419, Accession: P50213, SwissProt: P50213 |
|---|
| Catalog # | NBP1-54736 |
|---|
| Price | |
|---|
| Order / More Info | IDH3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|