| 产品详情 |
| Edit |   |
| Antigenic Specificity | Relaxin R1/LGR7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Relaxin R1/LGR7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Relaxin R1/LGR7. This antibody reacts with human. The Relaxin R1/LGR7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Relaxin R1/LGR7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS |
| Other Names | leucine-rich repeat-containing G protein-coupled receptor 7, Leucine-rich repeat-containing G-protein coupled receptor 7, LGR7.1, LGR7.10, LGR7LGR7.2, MGC138347, MGC142177, Relaxin family peptide receptor 1, relaxin receptor 1, relaxin/insulin-like family peptide receptor 1, RXFPR1 |
| Gene, Accession # | RXFP1, Gene ID: 59350 |
| Catalog # | NBP1-89585 |
| Price | |
| Order / More Info | Relaxin R1/LGR7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|