| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FoxJ1/HFH4 |
|---|
| Clone | 5B2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FoxJ1/HFH4 Antibody (5B2) from Novus Biologicals is a mouse monoclonal antibody to FoxJ1/HFH4. This antibody reacts with human. The FoxJ1/HFH4 Antibody (5B2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FOXJ1 (NP_001445 341 a.a. - 421 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL |
|---|
| Other Names | FKHL13forkhead transcription factor HFH-4, forkhead box J1, forkhead-like 13, Forkhead-related protein FKHL13, Hepatocyte nuclear factor 3 forkhead homolog 4, HFH4fork head homologue 4, HFH-4forkhead box protein J1, MGC35202 |
|---|
| Gene, Accession # | FOXJ1, Gene ID: 2302, Accession: NP_001445, SwissProt: NP_001445 |
|---|
| Catalog # | H00002302-M01 |
|---|
| Price | |
|---|
| Order / More Info | FoxJ1/HFH4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|