| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glucuronosyltransferase 1A1/UGT1A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glucuronosyltransferase 1A1/UGT1A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glucuronosyltransferase 1A1/UGT1A1. This antibody reacts with human. The Glucuronosyltransferase 1A1/UGT1A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UGT1A1(UDP glucuronosyltransferase 1 family, polypeptide A1) The peptide sequence was selected from the N terminal of UGT1A1. Peptide sequence DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR. |
|---|
| Other Names | bilirubin UDP-glucuronosyltransferase 1-1, bilirubin UDP-glucuronosyltransferase isozyme 1, Bilirubin-specific UDPGT isozyme 1, GNT1EC 2.4.1.17, HUG-BR1, UDP glucuronosyltransferase 1 family, polypeptide A1, UDP glycosyltransferase 1 family, polypeptide A1, UDP-glucuronosyltransferase 1-1, UDP-glucuronosyltransferase 1-A, UDP-glucuronosyltransferase 1A1, UDPGT, UGT1*1, UGT1.1, UGT1-01, UGT-1A, UGT1AUDPGT 1-1, UGT1BILIQTL1 |
|---|
| Gene, Accession # | UGT1A1, Gene ID: 54658, Accession: P22309, SwissProt: P22309 |
|---|
| Catalog # | NBP1-62431 |
|---|
| Price | |
|---|
| Order / More Info | Glucuronosyltransferase 1A1/UGT1A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|