| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CAPZB |
|---|
| Clone | 1H1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CAPZB Antibody (1H1) from Novus Biologicals is a mouse monoclonal antibody to CAPZB. This antibody reacts with human. The CAPZB Antibody (1H1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | CAPZB (NP_004921 192 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
|---|
| Other Names | Cap Z, CAPB, CAPPB, capping protein (actin filament) muscle Z-line, beta, CAPZ, CapZ beta, F-actin capping protein beta subunit, F-actin-capping protein subunit beta, MGC104401, MGC129749, MGC129750 |
|---|
| Gene, Accession # | CAPZB, Gene ID: 832, Accession: NP_004921, SwissProt: NP_004921 |
|---|
| Catalog # | H00000832-M02 |
|---|
| Price | |
|---|
| Order / More Info | CAPZB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|