| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CAPZB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CAPZB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAPZB. This antibody reacts with human. The CAPZB Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CAPZB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSP |
|---|
| Other Names | Cap Z, CAPB, CAPPB, capping protein (actin filament) muscle Z-line, beta, CAPZ, CapZ beta, F-actin capping protein beta subunit, F-actin-capping protein subunit beta, MGC104401, MGC129749, MGC129750 |
|---|
| Gene, Accession # | CAPZB, Gene ID: 832 |
|---|
| Catalog # | NBP2-54936 |
|---|
| Price | |
|---|
| Order / More Info | CAPZB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|