| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOX3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOX3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOX3. This antibody reacts with human. The TOX3 Antibody has been validated for the following applications: Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TOX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP |
|---|
| Other Names | CAG trinucleotide repeat-containing gene F9 protein, CAGF9trinucleotide repeat containing 9, TNRC9, TOX high mobility group box family member 3, Trinucleotide repeat-containing gene 9 protein |
|---|
| Gene, Accession # | TOX3, Gene ID: 27324 |
|---|
| Catalog # | NBP1-86676 |
|---|
| Price | |
|---|
| Order / More Info | TOX3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|