| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOX2. This antibody reacts with human. The TOX2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR |
|---|
| Other Names | C20orf100, chromosome 20 open reading frame 100, dJ495O3.1, GCX1, GCX-1dJ1108D11.2, granulosa cell HMG box 1, Granulosa cell HMG box protein 1, granulosa cell HMG-box protein 1, MGC15880, TOX high mobility group box family member 2 |
|---|
| Gene, Accession # | TOX2, Gene ID: 84969 |
|---|
| Catalog # | NBP2-58503 |
|---|
| Price | |
|---|
| Order / More Info | TOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|