| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT9. This antibody reacts with human. The NUDT9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NUDT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL |
|---|
| Other Names | ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, ADP-ribose pyrosphosphatase NUDT9, ADPR-PPase, EC 3.6.1.13, MGC3037, mitochondrial, nucleoside diphosphate linked moiety X-type motif 9, nudix (nucleoside diphosphate linked moiety X)-type motif 9, Nudix motif 9, NUDT10 |
|---|
| Gene, Accession # | NUDT9, Gene ID: 53343 |
|---|
| Catalog # | NBP2-48818 |
|---|
| Price | |
|---|
| Order / More Info | NUDT9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|