| Edit |   |
|---|
| Antigenic Specificity | CDKL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDKL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDKL5. This antibody reacts with human. The CDKL5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human CDKL5The immunogen for this antibody is CDKL5. Peptide sequence SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT. |
|---|
| Other Names | cyclin-dependent kinase-like 5, serine/threonine kinase 9, serine/threonine-protein kinase 9 |
|---|
| Gene, Accession # | CDKL5, Gene ID: 6792, Accession: NP_003150, SwissProt: NP_003150 |
|---|
| Catalog # | NBP1-79782 |
|---|
| Price | |
|---|
| Order / More Info | CDKL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|