| Edit |   |
| Antigenic Specificity | CDKL5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDKL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDKL5. This antibody reacts with human. The CDKL5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human CDKL5The immunogen for this antibody is CDKL5. Peptide sequence SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT. |
| Other Names | cyclin-dependent kinase-like 5, serine/threonine kinase 9, serine/threonine-protein kinase 9 |
| Gene, Accession # | CDKL5, Gene ID: 6792, Accession: NP_003150, SwissProt: NP_003150 |
| Catalog # | NBP1-79782-20ul |
| Price | |
| Order / More Info | CDKL5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |