Edit |   |
Antigenic Specificity | Glucosidase, Alpha, Neutral C (GANC) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. |
Immunogen | GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
Other Names | 5830445O15Rik|9330160A12|mFLJ00088 |
Gene, Accession # | Gene ID: 2595 |
Catalog # | ABIN632846 |
Price | |
Order / More Info | Glucosidase, Alpha, Neutral C (GANC) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |