| Edit |   |
|---|
| Antigenic Specificity | FAM98B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM98B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM98B. This antibody reacts with human. The FAM98B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FAM98B(family with sequence similarity 98, member B) The peptide sequence was selected from the N terminal of FAM98B. Peptide sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI. |
|---|
| Other Names | family with sequence similarity 98, member B, FLJ38426 |
|---|
| Gene, Accession # | FAM98B, Gene ID: 283742, Accession: A8MUW5, SwissProt: A8MUW5 |
|---|
| Catalog # | NBP1-56796 |
|---|
| Price | |
|---|
| Order / More Info | FAM98B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|