| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Skp2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Skp2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Skp2. This antibody reacts with human. The Skp2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Skp2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS |
|---|
| Other Names | CDK2/cyclin A-associated protein p45, cyclin A/CDK2-associated protein p45, Cyclin-A/CDK2-associated protein p45, FBL1, F-box protein Skp2, F-box/LRR-repeat protein 1, FBXL1MGC1366, FLB1, p45skp2, S-phase kinase-associated protein 2, S-phase kinase-associated protein 2 (p45) |
|---|
| Gene, Accession # | SKP2, Gene ID: 6502 |
|---|
| Catalog # | NBP2-49142 |
|---|
| Price | |
|---|
| Order / More Info | Skp2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|