| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Skp1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Skp1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Skp1. This antibody reacts with human. The Skp1 Antibody has been validated for the following applications: Western Blot, Proximity Ligation Assay. |
|---|
| Immunogen | SKP1 (NP_008861.2, 1 a.a. - 160 a.a.) full-length human protein. MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL |
|---|
| Other Names | Cyclin-A/CDK2-associated protein p19, EMC19p19skp1, MGC34403, OCP2OCP-2, OCP-IIS-phase kinase-associated protein 1A (p19A), Organ of Corti protein 2, Organ of Corti protein II, p19Acyclin A/CDK2-associated p19, RNA polymerase II elongation factor-like protein, RNA polymerase II elongation factor-like protein OCP2, SKP1Acyclin A/CDK2-associated protein p19, S-phase kinase-associated protein 1, TCEB1LSIII, Transcription elongation factor B |
|---|
| Gene, Accession # | SKP1, Gene ID: 6500, Accession: NP_008861.2, SwissProt: NP_008861.2 |
|---|
| Catalog # | H00006500-D01P |
|---|
| Price | |
|---|
| Order / More Info | Skp1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|