| 产品详情 |
| Edit |   |
| Antigenic Specificity | Skp1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Skp1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Skp1. This antibody reacts with human. The Skp1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Skp1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE |
| Other Names | Cyclin-A/CDK2-associated protein p19, EMC19p19skp1, MGC34403, OCP2OCP-2, OCP-IIS-phase kinase-associated protein 1A (p19A), Organ of Corti protein 2, Organ of Corti protein II, p19Acyclin A/CDK2-associated p19, RNA polymerase II elongation factor-like protein, RNA polymerase II elongation factor-like protein OCP2, SKP1Acyclin A/CDK2-associated protein p19, S-phase kinase-associated protein 1, TCEB1LSIII, Transcription elongation factor B |
| Gene, Accession # | SKP1, Gene ID: 6500 |
| Catalog # | NBP2-58725 |
| Price | |
| Order / More Info | Skp1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|