| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CENTB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Recommended conditions for ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, Recommended conditions for IHC: Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CENTB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CENTB1. This antibody reacts with human. The CENTB1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK |
|---|
| Other Names | Arf GAP with coiled coil, ANK repeat and PH domains 1, arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1, centaurin, beta 1, Centaurin-beta-1, CENTB1cnt-b1, Cnt-b1, KIAA0050centaurin-beta-1 |
|---|
| Gene, Accession # | ACAP1, Gene ID: 9744 |
|---|
| Catalog # | NBP2-69009 |
|---|
| Price | |
|---|
| Order / More Info | CENTB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|