| 产品详情 |
| Edit |   |
| Antigenic Specificity | Centaurin beta 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Centaurin beta 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Centaurin beta 2. This antibody reacts with human. The Centaurin beta 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Centaurin beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE |
| Other Names | Arf GAP with coiled coil, ANK repeat and PH domains 2, ArfGAP with coiled-coil, ankyrin repeat and PH domains 2, centaurin, beta 2, Centaurin-beta-2, CENTB2centaurin-beta-2, CNT-B2, KIAA0041arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 |
| Gene, Accession # | ACAP2, Gene ID: 23527 |
| Catalog # | NBP1-84544 |
| Price | |
| Order / More Info | Centaurin beta 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|