| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD97 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 24949957). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD97 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD97. This antibody reacts with human, mouse. The CD97 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD97 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ |
|---|
| Other Names | CD97 antigenseven-span transmembrane protein, CD97 molecule, Leukocyte antigen CD97, seven transmembrane helix receptor, seven-transmembrane, heterodimeric receptor associated with inflammation, TM7LN1 |
|---|
| Gene, Accession # | CD97, Gene ID: 976 |
|---|
| Catalog # | NBP1-86935 |
|---|
| Price | |
|---|
| Order / More Info | CD97 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24949957 |
|---|
| 产品资料 |
|
|