| Edit |   |
| Antigenic Specificity | MED8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MED8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED8. This antibody reacts with human. The MED8 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: 8 |
| Immunogen | Synthetic peptides corresponding to MED8(mediator complex subunit 8) The peptide sequence was selected from the N terminal of MED8. Peptide sequence MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA. |
| Other Names | ARC32subunit 8 homolog, mediator complex subunit 8mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae) |
| Gene, Accession # | MED8, Gene ID: 112950, Accession: Q96G25-2, SwissProt: Q96G25-2 |
| Catalog # | NBP1-55435 |
| Price | |
| Order / More Info | MED8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |