| 产品详情 |
| Edit |   |
| Antigenic Specificity | MED7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Chromatin Immunoprecipitation |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MED7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED7. This antibody reacts with human. The MED7 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation. |
| Immunogen | The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE. |
| Other Names | Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33 |
| Gene, Accession # | MED7, Gene ID: 9443, Accession: NP_004261, SwissProt: NP_004261 |
| Catalog # | NBP1-98339-20ul |
| Price | |
| Order / More Info | MED7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|