| 产品详情 |
| Edit |   |
| Antigenic Specificity | CD229/SLAMF3/Lymphocyte Antigen 9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD229/SLAMF3/Lymphocyte Antigen 9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD229/SLAMF3/Lymphocyte Antigen 9. This antibody reacts with human. The CD229/SLAMF3/Lymphocyte Antigen 9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD229/SLAMF3/Lymphocyte Antigen 9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE |
| Other Names | CD229, CD229 antigen, cell-surface molecule Ly-9, hly9, lymphocyte antigen 9Cell surface molecule Ly-9, mLY9, SLAMF3, T-lymphocyte surface antigen Ly-9 |
| Gene, Accession # | LY9, Gene ID: 4063, Accession: Q9HBG7, SwissProt: Q9HBG7 |
| Catalog # | NBP2-30776 |
| Price | |
| Order / More Info | CD229/SLAMF3/Lymphocyte Antigen 9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|