| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD84/SLAMF5 |
|---|
| Clone | 3G10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD84/SLAMF5 Antibody (3G10) from Novus Biologicals is a mouse monoclonal antibody to CD84/SLAMF5. This antibody reacts with human. The CD84/SLAMF5 Antibody (3G10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CD84 (NP_003865.1, 22 a.a. - 121 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT |
|---|
| Other Names | CD84 antigen, CD84 antigen (leukocyte antigen), CD84 molecule, Cell surface antigen MAX.3, DKFZp781E2378, hCD84, hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, Leukocyte differentiation antigen CD84, mCD84, Signaling lymphocytic activation molecule 5, SLAM family member 5, SLAMF5LY9B |
|---|
| Gene, Accession # | CD84, Gene ID: 8832, Accession: NP_003865, SwissProt: NP_003865 |
|---|
| Catalog # | H00008832-M01 |
|---|
| Price | |
|---|
| Order / More Info | CD84/SLAMF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|