| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI 3-Kinase p110 gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PI 3-Kinase p110 gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 3-Kinase p110 gamma. This antibody reacts with human. The PI 3-Kinase p110 gamma Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PI 3-Kinase p110 gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT |
|---|
| Other Names | 1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma |
|---|
| Gene, Accession # | PIK3CG, Gene ID: 5294 |
|---|
| Catalog # | NBP2-57013 |
|---|
| Price | |
|---|
| Order / More Info | PI 3-Kinase p110 gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|