| Edit |   |
|---|
| Antigenic Specificity | Treacher Collins syndrome protein |
|---|
| Clone | 8H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Treacher Collins syndrome protein Antibody (8H3) from Novus Biologicals is a mouse monoclonal antibody to Treacher Collins syndrome protein. This antibody reacts with human. The Treacher Collins syndrome protein Antibody (8H3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | TCOF1 (NP_001008657, 2 a.a. - 82 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI |
|---|
| Other Names | MFD1, nucleolar trafficking phosphoprotein, TCS1, Treacher Collins syndrome protein, Treacher Collins-Franceschetti syndrome 1, treacle, treacle protein |
|---|
| Gene, Accession # | TCOF1, Gene ID: 6949, Accession: NP_001008657, SwissProt: NP_001008657 |
|---|
| Catalog # | H00006949-M02 |
|---|
| Price | |
|---|
| Order / More Info | Treacher Collins syndrome protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|