| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRBP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRBP. This antibody reacts with human. The TRBP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDS SLPEDIPVFTAAAAAT |
| Other Names | LOQS, RISC-loading complex subunit TARBP2, TAR (HIV) RNA binding protein 2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TAR RNA-binding protein 2, trans-activation responsive RNA-binding protein, Trans-activation-responsive RNA-binding protein, TRBP, TRBP1, TRBP2 |
| Gene, Accession # | TARBP2, Gene ID: 6895 |
| Catalog # | NBP2-13411 |
| Price | |
| Order / More Info | TRBP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|