| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TR beta 1/NR1A2/Thyroid Hormone Receptor beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to TR beta 1/NR1A2/Thyroid Hormone Receptor beta. This antibody reacts with human. The TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TR beta 1/NR1A2/Thyroid Hormone Receptor beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |
|---|
| Other Names | avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian) |
|---|
| Gene, Accession # | THRB, Gene ID: 7068 |
|---|
| Catalog # | NBP2-57253 |
|---|
| Price | |
|---|
| Order / More Info | TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|