| Edit |   |
|---|
| Antigenic Specificity | PELI3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PELI3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PELI3. This antibody reacts with human. The PELI3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PELI3(pellino homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of PELI3. Peptide sequence VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG. |
|---|
| Other Names | MGC35521, pellino 3, pellino homolog 3 (Drosophila), Pellino-3, protein pellino homolog 3 |
|---|
| Gene, Accession # | PELI3, Gene ID: 246330, Accession: Q8N2H9-2, SwissProt: Q8N2H9-2 |
|---|
| Catalog # | NBP1-56410 |
|---|
| Price | |
|---|
| Order / More Info | PELI3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|