| Edit |   |
| Antigenic Specificity | PELI3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PELI3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PELI3. This antibody reacts with human. The PELI3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PELI3(pellino homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of PELI3. Peptide sequence VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG. |
| Other Names | MGC35521, pellino 3, pellino homolog 3 (Drosophila), Pellino-3, protein pellino homolog 3 |
| Gene, Accession # | PELI3, Gene ID: 246330, Accession: Q8N2H9-2, SwissProt: Q8N2H9-2 |
| Catalog # | NBP1-56410-20ul |
| Price | |
| Order / More Info | PELI3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |