| Edit |   |
|---|
| Antigenic Specificity | CNNM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNNM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNNM2. This antibody reacts with human. The CNNM2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CNNM2(cyclin M2) The peptide sequence was selected from the middle region of CNNM2. Peptide sequence EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL. |
|---|
| Other Names | cyclin M2, metal transporter CNNM2 |
|---|
| Gene, Accession # | CNNM2, Gene ID: 54805 |
|---|
| Catalog # | NBP1-70502 |
|---|
| Price | |
|---|
| Order / More Info | CNNM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|