| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HERC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HERC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HERC2. This antibody reacts with human. The HERC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HERC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDMDDAAYSMSTGAVVTESQTYK |
|---|
| Other Names | D15F37S1, DKFZp547P028, E3 ubiquitin-protein ligase HERC2, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 2, hect domain and RLD 2, jdf2, KIAA0393, p528, probable E3 ubiquitin-protein ligase HERC2, SHEP1 |
|---|
| Gene, Accession # | HERC2, Gene ID: 8924, Accession: O95714, SwissProt: O95714 |
|---|
| Catalog # | NBP2-37922 |
|---|
| Price | |
|---|
| Order / More Info | HERC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|