| Edit |   |
|---|
| Antigenic Specificity | Hephaestin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hephaestin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hephaestin. This antibody reacts with human. The Hephaestin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HEPH(hephaestin) The peptide sequence was selected from the N terminal of HEPH. Peptide sequence MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG. |
|---|
| Other Names | EC 1.16.3.1, hephaestin, KIAA0698CPL |
|---|
| Gene, Accession # | HEPH, Gene ID: 9843, Accession: B1AJX8, SwissProt: B1AJX8 |
|---|
| Catalog # | NBP1-62496 |
|---|
| Price | |
|---|
| Order / More Info | Hephaestin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|