| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hepcidin Antimicrobial Peptide |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, bovine |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hepcidin Antimicrobial Peptide Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hepcidin Antimicrobial Peptide. This antibody reacts with human, mouse, bovine. The Hepcidin Antimicrobial Peptide Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM. |
|---|
| Other Names | hepcidin antimicrobial peptide, HEPCPutative liver tumor regressor, HFE2Bhepcidin, LEAP-1, LEAP1PLTR, Liver-expressed antimicrobial peptide 1 |
|---|
| Gene, Accession # | HAMP, Gene ID: 57817, Accession: P81172, SwissProt: P81172 |
|---|
| Catalog # | NBP1-59337 |
|---|
| Price | |
|---|
| Order / More Info | Hepcidin Antimicrobial Peptide Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26305890 |
|---|
| 产品资料 |
|
|