| Edit |   |
| Antigenic Specificity | SPATC1L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATC1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATC1L. This antibody reacts with human. The SPATC1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human C21orf56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDD |
| Other Names | chromosome 21 open reading frame 56, DKFZp434N0650, MGC99490 |
| Gene, Accession # | SPATC1L, Gene ID: 84221 |
| Catalog # | NBP1-91032 |
| Price | |
| Order / More Info | SPATC1L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |