| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ORC5L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ORC5L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ORC5L. This antibody reacts with human. The ORC5L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ORC5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA |
|---|
| Other Names | ORC5Lorigin recognition complex, subunit 5-like (yeast), ORC5P, ORC5T, origin recognition complex subunit 5, origin recognition complex, subunit 5, origin recognition complex, subunit 5 (yeast homolog)-like, origin recognition complex, subunit 5 homolog (yeast), origin recognition complex, subunit 5-like |
|---|
| Gene, Accession # | ORC5, Gene ID: 5001 |
|---|
| Catalog # | NBP1-82476 |
|---|
| Price | |
|---|
| Order / More Info | ORC5L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|