| Edit |   |
|---|
| Antigenic Specificity | FIBCD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FIBCD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FIBCD1. This antibody reacts with human. The FIBCD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY. |
|---|
| Other Names | fibrinogen C domain containing 1 |
|---|
| Gene, Accession # | FIBCD1, Gene ID: 84929, Accession: NP_116232, SwissProt: NP_116232 |
|---|
| Catalog # | NBP1-91362 |
|---|
| Price | |
|---|
| Order / More Info | FIBCD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|