| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPATA19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Western Blot reactivity reported in (PMID: 26265198). IHC-P, ICC/IF, WB reported in the scientific literature (PMID: 26265198). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA19. This antibody reacts with human, mouse. The SPATA19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse SPATA19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSS |
|---|
| Other Names | cancer/testis antigen 132, CT132, FLJ25851, SPAS1, spergen 1, spergen1, spergen-1, spermatogenesis associated 19, spermatogenesis-associated protein 19, mitochondrial, Spermatogenic cell-specific gene 1 protein, spermatogenic specific-gene1 |
|---|
| Gene, Accession # | SPATA19, Gene ID: 219938, Accession: Q7Z5L4, SwissProt: Q7Z5L4 |
|---|
| Catalog # | NBP2-31979 |
|---|
| Price | |
|---|
| Order / More Info | SPATA19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26265198 |
|---|
| 产品资料 |
|
|