| Edit |   |
|---|
| Antigenic Specificity | SPATA16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPATA16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA16. This antibody reacts with human. The SPATA16 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SPATA16(spermatogenesis associated 16) The peptide sequence was selected from the N terminal of SPATA16. Peptide sequence MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN. |
|---|
| Other Names | NYD-SP12, spermatogenesis associated 16, Testis development protein NYD-SP12, testis-specific Golgi protein |
|---|
| Gene, Accession # | SPATA16, Gene ID: 83893, Accession: Q9BXB7, SwissProt: Q9BXB7 |
|---|
| Catalog # | NBP1-55464 |
|---|
| Price | |
|---|
| Order / More Info | SPATA16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|