| Edit |   |
| Antigenic Specificity | SPATA13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATA13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA13. This antibody reacts with human. The SPATA13 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human SPATA13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLT |
| Other Names | adenomatous polyposis coli stimulated exchange factor 2, FLJ35435, spermatogenesis associated 13 |
| Gene, Accession # | SPATA13, Gene ID: 221178 |
| Catalog # | NBP1-90848 |
| Price | |
| Order / More Info | SPATA13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |