| Edit |   |
| Antigenic Specificity | SPATA12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATA12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATA12. This antibody reacts with human. The SPATA12 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human SPATA12The immunogen for this antibody is SPATA12. Peptide sequence MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCA. |
| Other Names | spermatogenesis associated 12, spermatogenesis-associated protein 12, SRG5Spermatogenesis-related protein 5 |
| Gene, Accession # | SPATA12, Gene ID: 353324, Accession: NP_859078, SwissProt: NP_859078 |
| Catalog # | NBP1-79430-20ul |
| Price | |
| Order / More Info | SPATA12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |