| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIGB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIGB Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIGB. This antibody reacts with human, mouse, rat. The PIGB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PIGB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD |
|---|
| Other Names | EC 2.4.1, EC 2.4.1.-, GPI mannosyltransferase 3, GPI mannosyltransferase III, GPI-MT-III, MGC21236, phosphatidylinositol glycan anchor biosynthesis, class B, phosphatidylinositol glycan, class B, Phosphatidylinositol-glycan biosynthesis class B protein, PIG-B |
|---|
| Gene, Accession # | PIGB, Gene ID: 9488 |
|---|
| Catalog # | NBP1-85856 |
|---|
| Price | |
|---|
| Order / More Info | PIGB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|