| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIGA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIGA Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIGA. This antibody reacts with human. The PIGA Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: A |
|---|
| Immunogen | Synthetic peptides corresponding to PIGA(phosphatidylinositol glycan anchor biosynthesis, class A) The peptide sequence was selected from the middle region of PIGA. Peptide sequence SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR. |
|---|
| Other Names | class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A |
|---|
| Gene, Accession # | PIGA, Gene ID: 5277, Accession: B3KUV7, SwissProt: B3KUV7 |
|---|
| Catalog # | NBP1-59701 |
|---|
| Price | |
|---|
| Order / More Info | PIGA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|